Lineage for d1gmva2 (1gmv A:71-138)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562406Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family) (S)
    automatically mapped to Pfam PF05194
  5. 2562407Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (2 proteins)
  6. 2562408Protein Urease metallochaperone UreE, C-terminal domain [69739] (2 species)
  7. 2562412Species Klebsiella aerogenes [TaxId:28451] [69740] (3 PDB entries)
  8. 2562421Domain d1gmva2: 1gmv A:71-138 [65344]
    Other proteins in same PDB: d1gmva1, d1gmvb1

Details for d1gmva2

PDB Entry: 1gmv (more details), 2.8 Å

PDB Description: structure of uree
PDB Compounds: (A:) uree

SCOPe Domain Sequences for d1gmva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmva2 d.58.38.1 (A:71-138) Urease metallochaperone UreE, C-terminal domain {Klebsiella aerogenes [TaxId: 28451]}
deevsvvrcddpfmlakacyhlgnrhvplqimpgelryhadhvlddmlrqfgltvtfgql
pfepeaga

SCOPe Domain Coordinates for d1gmva2:

Click to download the PDB-style file with coordinates for d1gmva2.
(The format of our PDB-style files is described here.)

Timeline for d1gmva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gmva1