Lineage for d1gmud1 (1gmu D:1-70)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1562717Fold b.107: Urease metallochaperone UreE, N-terminal domain [69286] (1 superfamily)
    barrel, closed; n=6, S=8; a crossover loop topology
  4. 1562718Superfamily b.107.1: Urease metallochaperone UreE, N-terminal domain [69287] (1 family) (S)
    automatically mapped to Pfam PF02814
  5. 1562719Family b.107.1.1: Urease metallochaperone UreE, N-terminal domain [69288] (2 proteins)
  6. 1562720Protein Urease metallochaperone UreE, N-terminal domain [69289] (2 species)
  7. 1562724Species Klebsiella aerogenes [TaxId:28451] [69290] (3 PDB entries)
  8. 1562728Domain d1gmud1: 1gmu D:1-70 [65341]
    Other proteins in same PDB: d1gmua2, d1gmub2, d1gmuc2, d1gmud2

Details for d1gmud1

PDB Entry: 1gmu (more details), 1.5 Å

PDB Description: structure of uree
PDB Compounds: (D:) uree

SCOPe Domain Sequences for d1gmud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmud1 b.107.1.1 (D:1-70) Urease metallochaperone UreE, N-terminal domain {Klebsiella aerogenes [TaxId: 28451]}
mlyltqrleipaaatasvtlpidvrvksrvkvtlndgrdaglllprglllrggdvlsnee
gtefvqviaa

SCOPe Domain Coordinates for d1gmud1:

Click to download the PDB-style file with coordinates for d1gmud1.
(The format of our PDB-style files is described here.)

Timeline for d1gmud1: