Lineage for d1gmuc2 (1gmu C:71-140)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1655022Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family) (S)
    automatically mapped to Pfam PF05194
  5. 1655023Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (2 proteins)
  6. 1655024Protein Urease metallochaperone UreE, C-terminal domain [69739] (2 species)
  7. 1655028Species Klebsiella aerogenes [TaxId:28451] [69740] (3 PDB entries)
  8. 1655031Domain d1gmuc2: 1gmu C:71-140 [65340]
    Other proteins in same PDB: d1gmua1, d1gmub1, d1gmuc1, d1gmud1

Details for d1gmuc2

PDB Entry: 1gmu (more details), 1.5 Å

PDB Description: structure of uree
PDB Compounds: (C:) uree

SCOPe Domain Sequences for d1gmuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmuc2 d.58.38.1 (C:71-140) Urease metallochaperone UreE, C-terminal domain {Klebsiella aerogenes [TaxId: 28451]}
deevsvvrcddpfmlakacyalgnrhvplqimpgelryhhdhvlddmlrqfgltvtfgql
pfepeagaya

SCOPe Domain Coordinates for d1gmuc2:

Click to download the PDB-style file with coordinates for d1gmuc2.
(The format of our PDB-style files is described here.)

Timeline for d1gmuc2: