SCOP 1.63: Domain d1gmuc2: 1gmu C:71-140

Lineage for d1gmuc2 (1gmu C:71-140)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family)

5. Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (1 protein)

6. Protein Urease metallochaperone UreE, C-terminal domain [69739] (2 species)

7. Species Klebsiella aerogenes [TaxId:28451] [69740] (3 PDB entries)

8. Domain d1gmuc2: 1gmu C:71-140 [65340]
   Other proteins in same PDB: d1gmua1, d1gmub1, d1gmuc1, d1gmud1

Details for d1gmuc2

PDB Entry: 1gmu, 1.5 Å

PDB Description: structure of uree

SCOP Domain Sequences for d1gmuc2:

Sequence; same for both SEQRES and ATOM records:

>d1gmuc2 d.58.38.1 (C:71-140) Urease metallochaperone UreE, C-terminal domain {Klebsiella aerogenes}
deevsvvrcddpfmlakacyalgnrhvplqimpgelryhhdhvlddmlrqfgltvtfgql
pfepeagaya

Timeline for d1gmuc2:

• d1gmuc2 first appeared in SCOP 1.59
  
• d1gmuc2 appears in SCOP 1.61
  
• d1gmuc2 appears in SCOP 1.65
  
• d1gmuc2 appears in the current release, SCOPe 2.08