Lineage for d1gmub2 (1gmu B:71-138)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198365Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family) (S)
    automatically mapped to Pfam PF05194
  5. 2198366Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (2 proteins)
  6. 2198367Protein Urease metallochaperone UreE, C-terminal domain [69739] (2 species)
  7. 2198371Species Klebsiella aerogenes [TaxId:28451] [69740] (3 PDB entries)
  8. 2198373Domain d1gmub2: 1gmu B:71-138 [65338]
    Other proteins in same PDB: d1gmua1, d1gmub1, d1gmuc1, d1gmud1

Details for d1gmub2

PDB Entry: 1gmu (more details), 1.5 Å

PDB Description: structure of uree
PDB Compounds: (B:) uree

SCOPe Domain Sequences for d1gmub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmub2 d.58.38.1 (B:71-138) Urease metallochaperone UreE, C-terminal domain {Klebsiella aerogenes [TaxId: 28451]}
deevsvvrcddpfmlakacyalgnrhvplqimpgelryhhdhvlddmlrqfgltvtfgql
pfepeaga

SCOPe Domain Coordinates for d1gmub2:

Click to download the PDB-style file with coordinates for d1gmub2.
(The format of our PDB-style files is described here.)

Timeline for d1gmub2: