SCOP 1.59: Domain d1gmub2: 1gmu B:71-138

Lineage for d1gmub2 (1gmu B:71-138)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family)

5. Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (1 protein)

6. Protein Urease metallochaperone UreE, C-terminal domain [69739] (2 species)

7. Species Klebsiella aerogenes [TaxId:28451] [69740] (3 PDB entries)

8. Domain d1gmub2: 1gmu B:71-138 [65338]
   Other proteins in same PDB: d1gmua1, d1gmub1, d1gmuc1, d1gmud1

Details for d1gmub2

PDB Entry: 1gmu, 1.5 Å

PDB Description: structure of uree

SCOP Domain Sequences for d1gmub2:

Sequence; same for both SEQRES and ATOM records:

>d1gmub2 d.58.38.1 (B:71-138) Urease metallochaperone UreE, C-terminal domain {Klebsiella aerogenes}
deevsvvrcddpfmlakacyalgnrhvplqimpgelryhhdhvlddmlrqfgltvtfgql
pfepeaga

Timeline for d1gmub2:

• d1gmub2 is new in SCOP 1.59
  
• d1gmub2 appears in SCOP 1.61
  
• d1gmub2 appears in the current release, SCOPe 2.08