SCOPe 2.06: Domain d1gmoe2: 1gmo E:126-209

Lineage for d1gmoe2 (1gmo E:126-209)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries)

8. Domain d1gmoe2: 1gmo E:126-209 [65328]
   Other proteins in same PDB: d1gmoa1, d1gmob1, d1gmoc1, d1gmod1, d1gmoe1, d1gmof1, d1gmog1, d1gmoh1
   complexed with epe, so4

Details for d1gmoe2

PDB Entry: 1gmo, 3 Å

PDB Description: crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor

PDB Compounds: (E:) hepatocyte growth factor

SCOPe Domain Sequences for d1gmoe2:

Sequence; same for both SEQRES and ATOM records:

>d1gmoe2 g.14.1.1 (E:126-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcsev

Timeline for d1gmoe2:

• d1gmoe2 first appeared in SCOP 1.59
  
• d1gmoe2 appears in SCOPe 2.05
  
• d1gmoe2 appears in SCOPe 2.07
  
• d1gmoe2 appears in the current release, SCOPe 2.08