Lineage for d1gmoe2 (1gmo E:126-209)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033286Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 3033287Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries)
  8. 3033336Domain d1gmoe2: 1gmo E:126-209 [65328]
    Other proteins in same PDB: d1gmoa1, d1gmob1, d1gmoc1, d1gmod1, d1gmoe1, d1gmof1, d1gmog1, d1gmoh1
    complexed with epe, so4

Details for d1gmoe2

PDB Entry: 1gmo (more details), 3 Å

PDB Description: crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor
PDB Compounds: (E:) hepatocyte growth factor

SCOPe Domain Sequences for d1gmoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmoe2 g.14.1.1 (E:126-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcsev

SCOPe Domain Coordinates for d1gmoe2:

Click to download the PDB-style file with coordinates for d1gmoe2.
(The format of our PDB-style files is described here.)

Timeline for d1gmoe2: