Lineage for d1gl3a2 (1gl3 A:134-354)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331066Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 331067Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 331068Family d.81.1.1: GAPDH-like [55348] (3 proteins)
    has many additional secondary structures
  6. 331075Protein Aspartate beta-semialdehyde dehydrogenase [55361] (2 species)
  7. 331076Species Escherichia coli [TaxId:562] [55362] (2 PDB entries)
  8. 331077Domain d1gl3a2: 1gl3 A:134-354 [65283]
    Other proteins in same PDB: d1gl3a1, d1gl3b1

Details for d1gl3a2

PDB Entry: 1gl3 (more details), 2.6 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase in complex with nadp and substrate analogue s-methyl cysteine sulfoxide

SCOP Domain Sequences for d1gl3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl3a2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli}
nctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmghlyghvadelatp
ssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsreewkgqaetnkil
ntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndreitm
reltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwg

SCOP Domain Coordinates for d1gl3a2:

Click to download the PDB-style file with coordinates for d1gl3a2.
(The format of our PDB-style files is described here.)

Timeline for d1gl3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gl3a1