Lineage for d1gl3a2 (1gl3 A:134-354)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135038Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 135039Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 135040Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 135041Protein Aspartate beta-semialdehyde dehydrogenase [55361] (1 species)
  7. 135042Species Escherichia coli [TaxId:562] [55362] (2 PDB entries)
  8. 135043Domain d1gl3a2: 1gl3 A:134-354 [65283]
    Other proteins in same PDB: d1gl3a1, d1gl3b1

Details for d1gl3a2

PDB Entry: 1gl3 (more details), 2.6 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase in complex with nadp and substrate analogue s-methyl cysteine sulfoxide

SCOP Domain Sequences for d1gl3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl3a2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli}
nctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmghlyghvadelatp
ssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsreewkgqaetnkil
ntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndreitm
reltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwg

SCOP Domain Coordinates for d1gl3a2:

Click to download the PDB-style file with coordinates for d1gl3a2.
(The format of our PDB-style files is described here.)

Timeline for d1gl3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gl3a1