Lineage for d1gl3a1 (1gl3 A:1-133,A:355-367)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308490Protein Aspartate beta-semialdehyde dehydrogenase [51813] (2 species)
  7. 308491Species Escherichia coli [TaxId:562] [51814] (2 PDB entries)
  8. 308492Domain d1gl3a1: 1gl3 A:1-133,A:355-367 [65282]
    Other proteins in same PDB: d1gl3a2, d1gl3b2

Details for d1gl3a1

PDB Entry: 1gl3 (more details), 2.6 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase in complex with nadp and substrate analogue s-methyl cysteine sulfoxide

SCOP Domain Sequences for d1gl3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl3a1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli}
mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
dglnngirtfvggXaaeplrrmlrqla

SCOP Domain Coordinates for d1gl3a1:

Click to download the PDB-style file with coordinates for d1gl3a1.
(The format of our PDB-style files is described here.)

Timeline for d1gl3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gl3a2