Lineage for d1ga5e_ (1ga5 E:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523848Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 523849Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families) (S)
  5. 523863Family g.39.1.2: Nuclear receptor [57721] (12 proteins)
    duplication: two zinc-binding motifs
  6. 523895Protein Orphan nuclear receptor reverb DNA-binding domain [57734] (1 species)
  7. 523896Species Human (Homo sapiens) [TaxId:9606] [57735] (3 PDB entries)
  8. 523901Domain d1ga5e_: 1ga5 E: [65175]

Details for d1ga5e_

PDB Entry: 1ga5 (more details), 2.4 Å

PDB Description: crystal structure of the orphan nuclear receptor rev-erb(alpha) dna- binding domain bound to its cognate response element

SCOP Domain Sequences for d1ga5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ga5e_ g.39.1.2 (E:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens)}
vllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcqqc
rfkkclsvgmsrdavrfgrip

SCOP Domain Coordinates for d1ga5e_:

Click to download the PDB-style file with coordinates for d1ga5e_.
(The format of our PDB-style files is described here.)

Timeline for d1ga5e_: