Lineage for d1ga5e_ (1ga5 E:)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Orphan nuclear receptor reverb [57734] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57735] (3 PDB entries) 
Domain d1ga5e_: 1ga5 E: [65175]
Details for d1ga5e_
PDB Entry: 1ga5 (more details), 2.4 Å
PDB Description: crystal structure of the orphan nuclear receptor rev-erb(alpha) dna- binding domain bound to its cognate response element
SCOP Domain Sequences for d1ga5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ga5e_ g.39.1.2 (E:) Orphan nuclear receptor reverb {Human (Homo sapiens)}
vllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcqqc
rfkkclsvgmsrdavrfgrip
SCOP Domain Coordinates for d1ga5e_:
Click to download the PDB-style file with coordinates for d1ga5e_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ga5e_:
- d1ga5e_ is new in SCOP 1.59
- d1ga5e_ appears in SCOP 1.61
- d1ga5e_ appears in the current release, SCOPe 2.08
View in 3D
