Lineage for d1g3wa1 (1g3w A:4-64)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479098Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 1479099Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 1479100Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
    Uniprot P33120
  8. 1479105Domain d1g3wa1: 1g3w A:4-64 [65133]
    Other proteins in same PDB: d1g3wa2, d1g3wa3
    complexed with cd, so4

Details for d1g3wa1

PDB Entry: 1g3w (more details), 2.4 Å

PDB Description: cd-cys102ser dtxr
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1g3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3wa1 a.4.5.24 (A:4-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
lvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
m

SCOPe Domain Coordinates for d1g3wa1:

Click to download the PDB-style file with coordinates for d1g3wa1.
(The format of our PDB-style files is described here.)

Timeline for d1g3wa1: