Lineage for d1g3wa1 (1g3w A:4-64)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95425Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)
  6. 95426Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)
  7. 95427Species Corynebacterium diphtheriae [TaxId:1717] [46884] (15 PDB entries)
  8. 95429Domain d1g3wa1: 1g3w A:4-64 [65133]
    Other proteins in same PDB: d1g3wa2, d1g3wa3

Details for d1g3wa1

PDB Entry: 1g3w (more details), 2.4 Å

PDB Description: cd-cys102ser dtxr

SCOP Domain Sequences for d1g3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3wa1 a.4.5.24 (A:4-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
lvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
m

SCOP Domain Coordinates for d1g3wa1:

Click to download the PDB-style file with coordinates for d1g3wa1.
(The format of our PDB-style files is described here.)

Timeline for d1g3wa1: