SCOP 1.59: Domain d1g3wa1: 1g3w A:4-64

Lineage for d1g3wa1 (1g3w A:4-64)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families)

5. Family a.4.5.24: Iron-dependent represor protein [46882] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (15 PDB entries)

8. Domain d1g3wa1: 1g3w A:4-64 [65133]
   Other proteins in same PDB: d1g3wa2, d1g3wa3

Details for d1g3wa1

PDB Entry: 1g3w, 2.4 Å

PDB Description: cd-cys102ser dtxr

SCOP Domain Sequences for d1g3wa1:

Sequence; same for both SEQRES and ATOM records:

>d1g3wa1 a.4.5.24 (A:4-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
lvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
m

Timeline for d1g3wa1:

• d1g3wa1 is new in SCOP 1.59
  
• d1g3wa1 appears in SCOP 1.61
  
• d1g3wa1 appears in the current release, SCOPe 2.08