SCOP 1.67: Domain d1g3sa1: 1g3s A:4-64

Lineage for d1g3sa1 (1g3s A:4-64)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (15 PDB entries)

8. Domain d1g3sa1: 1g3s A:4-64 [65124]
   Other proteins in same PDB: d1g3sa2, d1g3sa3
   mutant

Details for d1g3sa1

PDB Entry: 1g3s, 2.4 Å

PDB Description: cys102ser dtxr

SCOP Domain Sequences for d1g3sa1:

Sequence; same for both SEQRES and ATOM records:

>d1g3sa1 a.4.5.24 (A:4-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
lvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
m

Timeline for d1g3sa1:

• d1g3sa1 first appeared in SCOP 1.59
  
• d1g3sa1 appears in SCOP 1.65
  
• d1g3sa1 appears in SCOP 1.69
  
• d1g3sa1 appears in the current release, SCOPe 2.08