Lineage for d1g05a_ (1g05 A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries) 
Domain d1g05a_: 1g05 A: [65076]
Details for d1g05a_
PDB Entry: 1g05 (more details), 2.45 Å
PDB Description: heterocycle-based mmp inhibitor with p2'substituents
SCOP Domain Sequences for d1g05a_:
Sequence, based on SEQRES records: (download)
>d1g05a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd
Sequence, based on observed residues (ATOM records): (download)
>d1g05a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhdltrfrlsqddingiqslygpppd
SCOP Domain Coordinates for d1g05a_:
Click to download the PDB-style file with coordinates for d1g05a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g05a_:
- d1g05a_ first appeared in SCOP 1.59
- d1g05a_ appears in SCOP 1.63
- d1g05a_ appears in the current release, SCOPe 2.08
View in 3D
