SCOPe 2.08: Domain d1g05a_: 1g05 A:

Lineage for d1g05a_ (1g05 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)

8. Domain d1g05a_: 1g05 A: [65076]
   complexed with bbh, ca, zn

Details for d1g05a_

PDB Entry: 1g05, 2.45 Å

PDB Description: heterocycle-based mmp inhibitor with p2'substituents

PDB Compounds: (A:) stromelysin-1 precursor

SCOPe Domain Sequences for d1g05a_:

Sequence, based on SEQRES records:

>d1g05a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd

Sequence, based on observed residues (ATOM records):

>d1g05a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhdltrfrlsqddingiqslygpppd

Timeline for d1g05a_:

• d1g05a_ first appeared in SCOP 1.59
  
• d1g05a_ appears in SCOPe 2.07