Lineage for d1fy3a_ (1fy3 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 802711Protein Heparin binding protein, HBP [50544] (1 species)
    multifunctional protein (synonym: CAP37, azurocidin)
  7. 802712Species Human (Homo sapiens) [TaxId:9606] [50545] (4 PDB entries)
  8. 802714Domain d1fy3a_: 1fy3 A: [65066]
    complexed with cl, eoh, nag; mutant

Details for d1fy3a_

PDB Entry: 1fy3 (more details), 1.89 Å

PDB Description: [g175q]hbp, a mutant of human heparin binding protein (cap37)
PDB Compounds: (A:) heparin-binding protein

SCOP Domain Sequences for d1fy3a_:

Sequence, based on SEQRES records: (download)

>d1fy3a_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]}
ivggrkarprqfpflasiqnqgrhfcggaliharfvmtaascfqsqnpgvstvvlgaydl
rrrerqsrqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveag
trcqvagwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdqgtplv
ceglahgvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa

Sequence, based on observed residues (ATOM records): (download)

>d1fy3a_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]}
ivggrkarprqfpflasiqnqgrhfcggaliharfvmtaascfvstvvlgaydlrrrerq
srqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveagtrcqva
gwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdqgtplvceglah
gvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa

SCOP Domain Coordinates for d1fy3a_:

Click to download the PDB-style file with coordinates for d1fy3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fy3a_: