Lineage for d1fy3a_ (1fy3 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2388492Protein Heparin binding protein, HBP [50544] (1 species)
    multifunctional protein (synonym: CAP37, azurocidin)
  7. 2388493Species Human (Homo sapiens) [TaxId:9606] [50545] (4 PDB entries)
  8. 2388495Domain d1fy3a_: 1fy3 A: [65066]
    complexed with cl, eoh, nag; mutant

Details for d1fy3a_

PDB Entry: 1fy3 (more details), 1.89 Å

PDB Description: [g175q]hbp, a mutant of human heparin binding protein (cap37)
PDB Compounds: (A:) heparin-binding protein

SCOPe Domain Sequences for d1fy3a_:

Sequence, based on SEQRES records: (download)

>d1fy3a_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]}
ivggrkarprqfpflasiqnqgrhfcggaliharfvmtaascfqsqnpgvstvvlgaydl
rrrerqsrqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveag
trcqvagwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdqgtplv
ceglahgvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa

Sequence, based on observed residues (ATOM records): (download)

>d1fy3a_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]}
ivggrkarprqfpflasiqnqgrhfcggaliharfvmtaascfvstvvlgaydlrrrerq
srqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveagtrcqva
gwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdqgtplvceglah
gvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa

SCOPe Domain Coordinates for d1fy3a_:

Click to download the PDB-style file with coordinates for d1fy3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fy3a_: