SCOP 1.63: Domain d1fgma2: 1fgm A:7-149

Lineage for d1fgma2 (1fgm A:7-149)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (8 PDB entries)

8. Domain d1fgma2: 1fgm A:7-149 [65010]
   Other proteins in same PDB: d1fgma1
   complexed with of1; mutant

Details for d1fgma2

PDB Entry: 1fgm, 1.9 Å

PDB Description: lipoxygenase-1 (soybean) at 100k, n694h mutant

SCOP Domain Sequences for d1fgma2:

Sequence, based on SEQRES records:

>d1fgma2 b.12.1.1 (A:7-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1}
kikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfleg
intslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfv
cnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records):

>d1fgma2 b.12.1.1 (A:7-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1}
kikgtvvlmpknelnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlga
gesafnihfewdgsmgipgafyiknymqvefflksltleatirfvcnswvyntklyksvr
iffanhty

Timeline for d1fgma2:

• d1fgma2 first appeared in SCOP 1.59
  
• d1fgma2 appears in SCOP 1.61
  
• d1fgma2 appears in SCOP 1.65
  
• d1fgma2 appears in the current release, SCOPe 2.08