Lineage for d1f4sp_ (1f4s P:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271076Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 271077Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repears are related by the pseudodyad
  5. 271078Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 271082Protein Ethanol regulon transcriptional activator ALCR DNA-binding domain [57713] (1 species)
  7. 271083Species Aspergillus nidulans and Emericella nidulans [57714] (4 PDB entries)
  8. 271086Domain d1f4sp_: 1f4s P: [64984]
    complexed with zn; mutant

Details for d1f4sp_

PDB Entry: 1f4s (more details)

PDB Description: structure of transcriptional factor alcr in complex with a target dna

SCOP Domain Sequences for d1f4sp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4sp_ g.38.1.1 (P:) Ethanol regulon transcriptional activator ALCR DNA-binding domain {Aspergillus nidulans and Emericella nidulans}
gsmadtrrrqnhscdpcrkgkrrcdapenrneanengwvscsnckrwnkdctfnwlssqr
sknss

SCOP Domain Coordinates for d1f4sp_:

Click to download the PDB-style file with coordinates for d1f4sp_.
(The format of our PDB-style files is described here.)

Timeline for d1f4sp_: