Lineage for d1f4sp_ (1f4s P:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035544Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 3035545Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repeats are related by the pseudo dyad
  5. 3035546Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 3035550Protein Ethanol regulon transcriptional activator ALCR DNA-binding domain [57713] (1 species)
  7. 3035551Species Emericella nidulans, also known as Aspergillus nidulans [TaxId:162425] [57714] (4 PDB entries)
  8. 3035555Domain d1f4sp_: 1f4s P: [64984]
    protein/DNA complex; complexed with zn

Details for d1f4sp_

PDB Entry: 1f4s (more details)

PDB Description: structure of transcriptional factor alcr in complex with a target dna
PDB Compounds: (P:) ethanol regulon transcriptional factor

SCOPe Domain Sequences for d1f4sp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4sp_ g.38.1.1 (P:) Ethanol regulon transcriptional activator ALCR DNA-binding domain {Emericella nidulans, also known as Aspergillus nidulans [TaxId: 162425]}
gsmadtrrrqnhscdpcrkgkrrcdapenrneanengwvscsnckrwnkdctfnwlssqr
sknss

SCOPe Domain Coordinates for d1f4sp_:

Click to download the PDB-style file with coordinates for d1f4sp_.
(The format of our PDB-style files is described here.)

Timeline for d1f4sp_: