Lineage for d1ez4b2 (1ez4 B:163-335)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680355Protein Lactate dehydrogenase [56339] (19 species)
  7. 1680467Species Lactobacillus pentosus [TaxId:1589] [69843] (1 PDB entry)
  8. 1680469Domain d1ez4b2: 1ez4 B:163-335 [64920]
    Other proteins in same PDB: d1ez4a1, d1ez4b1, d1ez4c1, d1ez4d1
    complexed with nad

Details for d1ez4b2

PDB Entry: 1ez4 (more details), 2.3 Å

PDB Description: crystal structure of non-allosteric l-lactate dehydrogenase from lactobacillus pentosus at 2.3 angstrom resolution
PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d1ez4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ez4b2 d.162.1.1 (B:163-335) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]}
tsldssrlrvalgkqfnvdprsvdayimgehgdsefaaystatigtrpvrdvakeqgvsd
ddlakledgvrnkaydiinlkgatfygigtalmriskailrdenavlpvgaymdgqygln
diyigtpaiiggtglkqiiesplsadelkkmqdsaatlkkvlndglaelenk

SCOPe Domain Coordinates for d1ez4b2:

Click to download the PDB-style file with coordinates for d1ez4b2.
(The format of our PDB-style files is described here.)

Timeline for d1ez4b2: