Lineage for d1ey3c_ (1ey3 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853155Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species)
  7. 2853156Species Norway rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries)
  8. 2853165Domain d1ey3c_: 1ey3 C: [64913]
    complexed with dak

Details for d1ey3c_

PDB Entry: 1ey3 (more details), 2.3 Å

PDB Description: structure of enoyl-coa hydratase complexed with the substrate dac-coa
PDB Compounds: (C:) enoyl-coa hydratase

SCOPe Domain Sequences for d1ey3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ey3c_ c.14.1.3 (C:) Enoyl-CoA hydratase (crotonase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
regmsafvekrkanfkdh

SCOPe Domain Coordinates for d1ey3c_:

Click to download the PDB-style file with coordinates for d1ey3c_.
(The format of our PDB-style files is described here.)

Timeline for d1ey3c_: