PDB entry 1ey3

View 1ey3 on RCSB PDB site
Description: structure of enoyl-coa hydratase complexed with the substrate dac-coa
Class: lyase
Keywords: beta-oxidation, crotonase, enoyl-coa hydratase, fatty acid metabolism, beta-elimination, syn-addition, concerted reaction, lyase
Deposited on 2000-05-05, released 2002-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ey3a_
  • Chain 'B':
    Compound: enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ey3b_
  • Chain 'C':
    Compound: enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ey3c_
  • Chain 'D':
    Compound: enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ey3d_
  • Chain 'E':
    Compound: enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ey3e_
  • Chain 'F':
    Compound: enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ey3f_
  • Heterogens: DAK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ey3A (A:)
    fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
    afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ey3B (B:)
    fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
    afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ey3C (C:)
    fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
    afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ey3D (D:)
    fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
    afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ey3E (E:)
    fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
    afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ey3F (F:)
    fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
    afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
    yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
    fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
    regmsafvekrkanfkdh