Lineage for d1eb6a_ (1eb6 A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein) Protein Fungal zinc peptidase [64336] (2 species) Species Aspergillus oryzae, deuterolysin [TaxId:5062] [69774] (1 PDB entry) 
Domain d1eb6a_: 1eb6 A: [64895]
Details for d1eb6a_
PDB Entry: 1eb6 (more details), 1 Å
PDB Description: deuterolysin from aspergillus oryzae
SCOP Domain Sequences for d1eb6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eb6a_ d.92.1.12 (A:) Fungal zinc peptidase {Aspergillus oryzae, deuterolysin}
tevtdckgdaesslttalsnaaklanqaaeaaesgdeskfeeyfkttdqqtrttvaerlr
avakeagstsggsttyhcndpygycepnvlaytlpskneiancdiyyselpplaqkchaq
dqatttlhefthapgvyqpgtedlgygydaatqlsaqdalnnadsyalyanaielkc
SCOP Domain Coordinates for d1eb6a_:
Click to download the PDB-style file with coordinates for d1eb6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eb6a_:
- d1eb6a_ first appeared in SCOP 1.59
- d1eb6a_ appears in SCOP 1.63
- d1eb6a_ appears in the current release, SCOPe 2.08
View in 3D