Lineage for d1ea0a1 (1ea0 A:1203-1472)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962283Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962474Superfamily b.80.4: Alpha subunit of glutamate synthase, C-terminal domain [69336] (1 family) (S)
  5. 962475Family b.80.4.1: Alpha subunit of glutamate synthase, C-terminal domain [69337] (1 protein)
    this is a repeat family; one repeat unit is 1ea0 A:1280-1300 found in domain
  6. 962476Protein Alpha subunit of glutamate synthase, C-terminal domain [69338] (2 species)
    Central domain (residues 423-780) may be a rudiment form of the FMN domain
  7. 962477Species Azospirillum brasilense [TaxId:192] [69339] (2 PDB entries)
  8. 962478Domain d1ea0a1: 1ea0 A:1203-1472 [64854]
    Other proteins in same PDB: d1ea0a2, d1ea0a3, d1ea0b2, d1ea0b3
    complexed with akg, f3s, fmn, omt

Details for d1ea0a1

PDB Entry: 1ea0 (more details), 3 Å

PDB Description: alpha subunit of a. brasilense glutamate synthase
PDB Compounds: (A:) glutamate synthase [nadph] large chain

SCOPe Domain Sequences for d1ea0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea0a1 b.80.4.1 (A:1203-1472) Alpha subunit of glutamate synthase, C-terminal domain {Azospirillum brasilense [TaxId: 192]}
grnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglqpg
hitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnknti
igntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvgdn
faagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfaae
ilndwarevtkfwqvvpkemlnrlevpvhl

SCOPe Domain Coordinates for d1ea0a1:

Click to download the PDB-style file with coordinates for d1ea0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ea0a1: