Lineage for d1ea0a1 (1ea0 A:1203-1472)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114932Fold b.80: Single-stranded right-handed beta-helix [51125] (5 superfamilies)
  4. 115019Superfamily b.80.4: Alpha subunit of glutamate synthase, C-terminal domain [69336] (1 family) (S)
  5. 115020Family b.80.4.1: Alpha subunit of glutamate synthase, C-terminal domain [69337] (1 protein)
    this is a repeat family; one repeat unit is 1ea0 A:1280-1300 found in domain
  6. 115021Protein Alpha subunit of glutamate synthase, C-terminal domain [69338] (1 species)
  7. 115022Species Azospirillum brasilense [TaxId:192] [69339] (1 PDB entry)
  8. 115023Domain d1ea0a1: 1ea0 A:1203-1472 [64854]
    Other proteins in same PDB: d1ea0a2, d1ea0a3, d1ea0b2, d1ea0b3

Details for d1ea0a1

PDB Entry: 1ea0 (more details), 3 Å

PDB Description: alpha subunit of a. brasilense glutamate synthase

SCOP Domain Sequences for d1ea0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea0a1 b.80.4.1 (A:1203-1472) Alpha subunit of glutamate synthase, C-terminal domain {Azospirillum brasilense}
grnevpdtldarivadarplfeegekmqlaynarntqraigtrlssmvtrkfgmfglqpg
hitirlrgtagqslgafavqgiklevmgdandyvgkglsggtivvrpttsspletnknti
igntvlygatagklfaagqagerfavrnsgatvvvegcgsngceymtggtavilgrvgdn
faagmtggmayvydlddslplyindesvifqrievghyesqlkhlieehvtetqsrfaae
ilndwarevtkfwqvvpkemlnrlevpvhl

SCOP Domain Coordinates for d1ea0a1:

Click to download the PDB-style file with coordinates for d1ea0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ea0a1: