Lineage for d1e9ib2 (1e9i B:1-139)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025940Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1025941Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 1025942Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1025985Protein Enolase [54828] (8 species)
  7. 1026017Species Escherichia coli [TaxId:562] [69710] (2 PDB entries)
  8. 1026023Domain d1e9ib2: 1e9i B:1-139 [64821]
    Other proteins in same PDB: d1e9ia1, d1e9ib1, d1e9ic1, d1e9id1
    complexed with mg, so4

Details for d1e9ib2

PDB Entry: 1e9i (more details), 2.48 Å

PDB Description: enolase from e.coli
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d1e9ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9ib2 d.54.1.1 (B:1-139) Enolase {Escherichia coli [TaxId: 562]}
skivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrflg
kgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanaka
aaaakgmplyehiaelngt

SCOPe Domain Coordinates for d1e9ib2:

Click to download the PDB-style file with coordinates for d1e9ib2.
(The format of our PDB-style files is described here.)

Timeline for d1e9ib2: