Lineage for d1e9ib1 (1e9i B:140-430)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 973407Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 973408Family c.1.11.1: Enolase [51605] (1 protein)
  6. 973409Protein Enolase [51606] (8 species)
    Fold of this protein slightly differs from common fold in topology
  7. 973441Species Escherichia coli [TaxId:562] [69396] (2 PDB entries)
  8. 973447Domain d1e9ib1: 1e9i B:140-430 [64820]
    Other proteins in same PDB: d1e9ia2, d1e9ib2, d1e9ic2, d1e9id2
    CASP4
    complexed with mg, so4

Details for d1e9ib1

PDB Entry: 1e9i (more details), 2.48 Å

PDB Description: enolase from e.coli
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d1e9ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9ib1 c.1.11.1 (B:140-430) Enolase {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq

SCOPe Domain Coordinates for d1e9ib1:

Click to download the PDB-style file with coordinates for d1e9ib1.
(The format of our PDB-style files is described here.)

Timeline for d1e9ib1: