Lineage for d1e9hd1 (1e9h D:175-309)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99168Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 99169Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 99170Family a.74.1.1: Cyclin [47955] (3 proteins)
  6. 99171Protein Cyclin A [47956] (2 species)
  7. 99175Species Human (Homo sapiens) [TaxId:9606] [47957] (6 PDB entries)
  8. 99192Domain d1e9hd1: 1e9h D:175-309 [64816]
    Other proteins in same PDB: d1e9ha_, d1e9hc_

Details for d1e9hd1

PDB Entry: 1e9h (more details), 2.5 Å

PDB Description: thr 160 phosphorylated cdk2 - human cyclin a3 complex with the inhibitor indirubin-5-sulphonate bound

SCOP Domain Sequences for d1e9hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e9hd1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens)}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOP Domain Coordinates for d1e9hd1:

Click to download the PDB-style file with coordinates for d1e9hd1.
(The format of our PDB-style files is described here.)

Timeline for d1e9hd1: