SCOP 1.59: Domain d1e9hb1: 1e9h B:175-309

Lineage for d1e9hb1 (1e9h B:175-309)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)

5. Family a.74.1.1: Cyclin [47955] (3 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (6 PDB entries)

8. Domain d1e9hb1: 1e9h B:175-309 [64813]
   Other proteins in same PDB: d1e9ha_, d1e9hc_

Details for d1e9hb1

PDB Entry: 1e9h, 2.5 Å

PDB Description: thr 160 phosphorylated cdk2 - human cyclin a3 complex with the inhibitor indirubin-5-sulphonate bound

SCOP Domain Sequences for d1e9hb1:

Sequence; same for both SEQRES and ATOM records:

>d1e9hb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens)}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d1e9hb1:

• d1e9hb1 is new in SCOP 1.59
  
• d1e9hb1 appears in SCOP 1.61
  
• d1e9hb1 appears in the current release, SCOPe 2.08