Lineage for d1e8ka_ (1e8k A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170368Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 170369Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 170370Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 170376Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 170377Species Caenorhabditis elegans, isoform 3 [TaxId:6239] [50899] (3 PDB entries)
  8. 170380Domain d1e8ka_: 1e8k A: [64797]

Details for d1e8ka_

PDB Entry: 1e8k (more details), 1.9 Å

PDB Description: cyclophilin 3 complexed with dipeptide ala-pro

SCOP Domain Sequences for d1e8ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ka_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3}
msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk

SCOP Domain Coordinates for d1e8ka_:

Click to download the PDB-style file with coordinates for d1e8ka_.
(The format of our PDB-style files is described here.)

Timeline for d1e8ka_: