PDB entry 1e8k

View 1e8k on RCSB PDB site
Description: cyclophilin 3 complexed with dipeptide ala-pro
Deposited on 2000-09-25, released 2001-09-20
The last revision prior to the SCOP 1.61 freeze date was dated 2001-09-20, with a file datestamp of 2001-09-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1826
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1e8ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e8kA (A:)
msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk