Lineage for d1fc6a4 (1fc6 A:78-156,A:249-463)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461308Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 proteins)
    includes N-terminal all-alpha subdomain
  6. 2461312Protein Photosystem II D1 C-terminal processing protease [68935] (1 species)
  7. 2461313Species Algae (Scenedesmus obliquus) [TaxId:3088] [52102] (4 PDB entries)
  8. 2461314Domain d1fc6a4: 1fc6 A:78-156,A:249-463 [64739]
    Other proteins in same PDB: d1fc6a3

Details for d1fc6a4

PDB Entry: 1fc6 (more details), 1.8 Å

PDB Description: photosystem ii d1 c-terminal processing protease
PDB Compounds: (A:) photosystem II d1 protease

SCOPe Domain Sequences for d1fc6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]}
vtseqllfleawravdrayvdksfngqswfklretylkkepmdrraqtydairkmlavld
dpftrflepsrlaalrrgtXkvtinpvtfttcsnvaaaalppgaakqqlgyvrlatfnsn
ttaaaqqaftelskqgvaglvldirnnggglfpagvnvarmlvdrgdlvliadsqgirdi
ysadgnsidsatplvvlvnrgtasasevlagalkdskrgliagertfgkgliqtvvdlsd
gsgvavtvaryqtpagvdinkigvspdvqldpevlptdlegvcrvlgsdaaprlf

SCOPe Domain Coordinates for d1fc6a4:

Click to download the PDB-style file with coordinates for d1fc6a4.
(The format of our PDB-style files is described here.)

Timeline for d1fc6a4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fc6a3