SCOPe 2.08: Domain d1fc6a4: 1fc6 A:78-156,A:249-463

Lineage for d1fc6a4 (1fc6 A:78-156,A:249-463)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 proteins)
   includes N-terminal all-alpha subdomain

6. Protein Photosystem II D1 C-terminal processing protease [68935] (1 species)

7. Species Algae (Scenedesmus obliquus) [TaxId:3088] [52102] (4 PDB entries)

8. Domain d1fc6a4: 1fc6 A:78-156,A:249-463 [64739]
   Other proteins in same PDB: d1fc6a3

Details for d1fc6a4

PDB Entry: 1fc6, 1.8 Å

PDB Description: photosystem ii d1 c-terminal processing protease

PDB Compounds: (A:) photosystem II d1 protease

SCOPe Domain Sequences for d1fc6a4:

Sequence; same for both SEQRES and ATOM records:

>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]}
vtseqllfleawravdrayvdksfngqswfklretylkkepmdrraqtydairkmlavld
dpftrflepsrlaalrrgtXkvtinpvtfttcsnvaaaalppgaakqqlgyvrlatfnsn
ttaaaqqaftelskqgvaglvldirnnggglfpagvnvarmlvdrgdlvliadsqgirdi
ysadgnsidsatplvvlvnrgtasasevlagalkdskrgliagertfgkgliqtvvdlsd
gsgvavtvaryqtpagvdinkigvspdvqldpevlptdlegvcrvlgsdaaprlf

Timeline for d1fc6a4:

• d1fc6a4 first appeared in SCOP 1.59
  
• d1fc6a4 appears in SCOPe 2.07