SCOP 1.57: Domain d1joed_: 1joe D:

Lineage for d1joed_ (1joe D:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)

6. Protein Autoinducer-2 production protein LuxS [64295] (4 species)

7. Species Haemophilus influenzae [TaxId:727] [64298] (2 PDB entries)

8. Domain d1joed_: 1joe D: [63213]

Details for d1joed_

PDB Entry: 1joe, 2.4 Å

PDB Description: crystal structure of autoinducer-2 production protein (luxs) from heamophilus influenzae

SCOP Domain Sequences for d1joed_:

Sequence; same for both SEQRES and ATOM records:

>d1joed_ d.185.1.2 (D:) Autoinducer-2 production protein LuxS {Haemophilus influenzae}
vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
gsytehsledaheiaknviargigvnkn

Timeline for d1joed_:

• d1joed_ is new in SCOP 1.57
  
• d1joed_ appears in SCOP 1.59
  
• d1joed_ appears in the current release, SCOPe 2.08