PDB entry 1joe

View 1joe on RCSB PDB site
Description: crystal structure of autoinducer-2 production protein (luxs) from heamophilus influenzae
Deposited on 2001-07-27, released 2001-08-08
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1joea_
  • Chain 'B':
    Domains in SCOP 1.57: d1joeb_
  • Chain 'C':
    Domains in SCOP 1.57: d1joec_
  • Chain 'D':
    Domains in SCOP 1.57: d1joed_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1joeA (A:)
    vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
    ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
    gsytehsledaheiaknviargigvnkn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1joeB (B:)
    vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
    ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
    gsytehsledaheiaknviargigvnkn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1joeC (C:)
    vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
    ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
    gsytehsledaheiaknviargigvnkn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1joeD (D:)
    vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl
    ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc
    gsytehsledaheiaknviargigvnkn