Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) |
Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein) |
Protein Autoinducer-2 production protein LuxS [64295] (4 species) |
Species Haemophilus influenzae [TaxId:727] [64298] (2 PDB entries) |
Domain d1joea_: 1joe A: [63210] |
PDB Entry: 1joe (more details), 2.4 Å
SCOP Domain Sequences for d1joea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1joea_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Haemophilus influenzae} vdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhl ngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqc gsytehsledaheiaknviargigvnkn
Timeline for d1joea_: