Class g: Small proteins [56992] (72 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (2 families) |
Family g.24.1.1: TNF receptor-like [57587] (3 proteins) |
Protein Cellular receptor HveA [64568] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64569] (1 PDB entry) |
Domain d1jmab1: 1jma B:4-59 [63178] Other proteins in same PDB: d1jmaa_ |
PDB Entry: 1jma (more details), 2.65 Å
SCOP Domain Sequences for d1jmab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmab1 g.24.1.1 (B:4-59) Cellular receptor HveA {Human (Homo sapiens)} ckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq
Timeline for d1jmab1: