SCOPe 2.08: Domain d1jmab1: 1jma B:4-59

Lineage for d1jmab1 (1jma B:4-59)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
   Pfam PF00020; TNFR/NGFR cysteine-rich region

6. Protein Cellular receptor HveA, N-terminal domain [419058] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419549] (2 PDB entries)

8. Domain d1jmab1: 1jma B:4-59 [63178]
   Other proteins in same PDB: d1jmaa_, d1jmab2
   complexed with so4
   has additional secondary structure elements or disulfide bonds beyond those in the common domain

Details for d1jmab1

PDB Entry: 1jma, 2.65 Å

PDB Description: crystal structure of the herpes simplex virus glycoprotein d bound to the cellular receptor hvea/hvem

PDB Compounds: (B:) herpesvirus entry mediator

SCOPe Domain Sequences for d1jmab1:

Sequence; same for both SEQRES and ATOM records:

>d1jmab1 g.24.1.1 (B:4-59) Cellular receptor HveA, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq

Timeline for d1jmab1:

• d1jmab1 first appeared in SCOP 1.57
  
• d1jmab1 appears in SCOPe 2.07