Lineage for d1jmab1 (1jma B:4-59)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90012Fold g.24: TNF receptor-like [57585] (1 superfamily)
  4. 90013Superfamily g.24.1: TNF receptor-like [57586] (1 family) (S)
  5. 90014Family g.24.1.1: TNF receptor-like [57587] (3 proteins)
  6. 90015Protein Cellular receptor HveA [64568] (1 species)
  7. 90016Species Human (Homo sapiens) [TaxId:9606] [64569] (1 PDB entry)
  8. 90017Domain d1jmab1: 1jma B:4-59 [63178]
    Other proteins in same PDB: d1jmaa_

Details for d1jmab1

PDB Entry: 1jma (more details), 2.65 Å

PDB Description: crystal structure of the herpes simplex virus glycoprotein d bound to the cellular receptor hvea/hvem

SCOP Domain Sequences for d1jmab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmab1 g.24.1.1 (B:4-59) Cellular receptor HveA {Human (Homo sapiens)}
ckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq

SCOP Domain Coordinates for d1jmab1:

Click to download the PDB-style file with coordinates for d1jmab1.
(The format of our PDB-style files is described here.)

Timeline for d1jmab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jmab2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jmaa_