Lineage for d1jlna_ (1jln A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1167639Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1167640Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1167712Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 1167744Protein Tyrosine phosphatase [52806] (7 species)
  7. 1167867Species Mouse (Mus musculus), ptp-sl/br7 [TaxId:10090] [64051] (1 PDB entry)
  8. 1167868Domain d1jlna_: 1jln A: [63172]

Details for d1jlna_

PDB Entry: 1jln (more details), 1.81 Å

PDB Description: Crystal structure of the catalytic domain of protein tyrosine phosphatase PTP-SL/BR7
PDB Compounds: (A:) Protein Tyrosine Phosphatase, receptor type, R

SCOPe Domain Sequences for d1jlna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]}
gsprekvameylqsasrvltrsqlrdvvasshllqsefmeipmnfvdpkeidiprhgtkn
ryktilpnplsrvclrpknitdslstyinanyirgysgkekafiatqgpmintvndfwqm
vwqedspvivmitklkeknekcvlywpekrgiygkvevlvtgvtecdnytirnlvlkqgs
htqhvkhywytswpdhktpdsaqpllqlmldveedrlasegrgpvvvhcsagigrtgcfi
atsigcqqlkeegvvdalsivcqlrvdrggmvqtseqyefvhhalclfesrlspetv

SCOPe Domain Coordinates for d1jlna_:

Click to download the PDB-style file with coordinates for d1jlna_.
(The format of our PDB-style files is described here.)

Timeline for d1jlna_: