Lineage for d1jlna_ (1jln A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) 
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins) Protein Tyrosine phosphatase [52806] (7 species) 
Species Mouse (Mus musculus), ptp-sl/br7 [TaxId:10090] [64051] (1 PDB entry) 
Domain d1jlna_: 1jln A: [63172]
Details for d1jlna_
PDB Entry: 1jln (more details), 1.81 Å
PDB Description: Crystal structure of the catalytic domain of protein tyrosine phosphatase PTP-SL/BR7
SCOP Domain Sequences for d1jlna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7}
gsprekvameylqsasrvltrsqlrdvvasshllqsefmeipmnfvdpkeidiprhgtkn
ryktilpnplsrvclrpknitdslstyinanyirgysgkekafiatqgpmintvndfwqm
vwqedspvivmitklkeknekcvlywpekrgiygkvevlvtgvtecdnytirnlvlkqgs
htqhvkhywytswpdhktpdsaqpllqlmldveedrlasegrgpvvvhcsagigrtgcfi
atsigcqqlkeegvvdalsivcqlrvdrggmvqtseqyefvhhalclfesrlspetv
SCOP Domain Coordinates for d1jlna_:
Click to download the PDB-style file with coordinates for d1jlna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jlna_:
- d1jlna_ is new in SCOP 1.57
- d1jlna_ appears in SCOP 1.59
- d1jlna_ appears in the current release, SCOPe 2.08, called d1jlna1
View in 3D