Lineage for d1jk7a_ (1jk7 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138907Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
  4. 138908Superfamily d.159.1: Metallo-dependent phosphatases [56300] (4 families) (S)
  5. 138936Family d.159.1.3: Protein serine/threonine phosphatase [56310] (3 proteins)
  6. 138942Protein Protein phosphatase-1 (PP-1) [56311] (2 species)
  7. 138943Species Human (Homo sapiens) [TaxId:9606] [64430] (1 PDB entry)
  8. 138944Domain d1jk7a_: 1jk7 A: [63144]

Details for d1jk7a_

PDB Entry: 1jk7 (more details), 1.9 Å

PDB Description: crystal structure of the tumor-promoter okadaic acid bound to protein phosphatase-1

SCOP Domain Sequences for d1jk7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens)}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOP Domain Coordinates for d1jk7a_:

Click to download the PDB-style file with coordinates for d1jk7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jk7a_: