Lineage for d1jk7a_ (1jk7 A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) Superfamily d.159.1: Metallo-dependent phosphatases [56300] (4 families) 
Family d.159.1.3: Protein serine/threonine phosphatase [56310] (3 proteins) Protein Protein phosphatase-1 (PP-1) [56311] (2 species) Species Human (Homo sapiens) [TaxId:9606] [64430] (1 PDB entry) 
Domain d1jk7a_: 1jk7 A: [63144]
Details for d1jk7a_
PDB Entry: 1jk7 (more details), 1.9 Å
PDB Description: crystal structure of the tumor-promoter okadaic acid bound to protein phosphatase-1
SCOP Domain Sequences for d1jk7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens)}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
SCOP Domain Coordinates for d1jk7a_:
Click to download the PDB-style file with coordinates for d1jk7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jk7a_:
- d1jk7a_ is new in SCOP 1.57
- d1jk7a_ appears in SCOP 1.59
- d1jk7a_ appears in the current release, SCOPe 2.08
View in 3D