Lineage for d1jjke_ (1jjk E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1566369Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1566456Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 1566510Species Escherichia coli [TaxId:562] [51378] (3 PDB entries)
  8. 1566521Domain d1jjke_: 1jjk E: [63126]
    complexed with bmp

Details for d1jjke_

PDB Entry: 1jjk (more details), 3 Å

PDB Description: selenomethionine substitution of orotidine-5'-monophosphate decarboxylase from e. coli causes a change in crystal contacts and space group
PDB Compounds: (E:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1jjke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjke_ c.1.2.3 (E:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]}
vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
rpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslq

SCOPe Domain Coordinates for d1jjke_:

Click to download the PDB-style file with coordinates for d1jjke_.
(The format of our PDB-style files is described here.)

Timeline for d1jjke_: