SCOPe 2.08: Domain d1jjhc_: 1jjh C:

Lineage for d1jjhc_ (1jjh C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (4 PDB entries)

8. Domain d1jjhc_: 1jjh C: [63121]
   Other proteins in same PDB: d1jjha2, d1jjhb2

Details for d1jjhc_

PDB Entry: 1jjh, 2.5 Å

PDB Description: e2 dna-binding domain from bovine papillomavirus type 1

PDB Compounds: (C:) Regulatory protein E2

SCOPe Domain Sequences for d1jjhc_:

Sequence, based on SEQRES records:

>d1jjhc_ d.58.8.1 (C:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
scfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgspsq
rqdflkhvplppgmnisgftasldf

Sequence, based on observed residues (ATOM records):

>d1jjhc_ d.58.8.1 (C:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
scfalisgtanqvkcyrfrvkknhrhryenctttwfaqilitfgspsqrqdflkhvplpp
gmnisgftasldf

Timeline for d1jjhc_:

• d1jjhc_ first appeared in SCOP 1.57
  
• d1jjhc_ appears in SCOPe 2.07