Lineage for d1jjhc_ (1jjh C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952704Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2952705Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2952726Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 2952727Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (4 PDB entries)
  8. 2952735Domain d1jjhc_: 1jjh C: [63121]
    Other proteins in same PDB: d1jjha2, d1jjhb2

Details for d1jjhc_

PDB Entry: 1jjh (more details), 2.5 Å

PDB Description: e2 dna-binding domain from bovine papillomavirus type 1
PDB Compounds: (C:) Regulatory protein E2

SCOPe Domain Sequences for d1jjhc_:

Sequence, based on SEQRES records: (download)

>d1jjhc_ d.58.8.1 (C:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
scfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgspsq
rqdflkhvplppgmnisgftasldf

Sequence, based on observed residues (ATOM records): (download)

>d1jjhc_ d.58.8.1 (C:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
scfalisgtanqvkcyrfrvkknhrhryenctttwfaqilitfgspsqrqdflkhvplpp
gmnisgftasldf

SCOPe Domain Coordinates for d1jjhc_:

Click to download the PDB-style file with coordinates for d1jjhc_.
(The format of our PDB-style files is described here.)

Timeline for d1jjhc_: