Lineage for d1jjhb_ (1jjh B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1028445Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 1028446Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 1028453Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 1028454Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (3 PDB entries)
  8. 1028457Domain d1jjhb_: 1jjh B: [63120]

Details for d1jjhb_

PDB Entry: 1jjh (more details), 2.5 Å

PDB Description: e2 dna-binding domain from bovine papillomavirus type 1
PDB Compounds: (B:) Regulatory protein E2

SCOPe Domain Sequences for d1jjhb_:

Sequence, based on SEQRES records: (download)

>d1jjhb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
ascfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqilitfgsps
qrqdflkhvplppgmnisgftasldf

Sequence, based on observed residues (ATOM records): (download)

>d1jjhb_ d.58.8.1 (B:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
ascfalisgtanqvkcyrfrvkknhrhryenctttwftvaqaqilitfgspsqrqdflkh
vplppgmnisgftasldf

SCOPe Domain Coordinates for d1jjhb_:

Click to download the PDB-style file with coordinates for d1jjhb_.
(The format of our PDB-style files is described here.)

Timeline for d1jjhb_: